PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g036170.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 27228.1 Da    PI: 9.6168
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g036170.2genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.32e-281059251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      ri+n++ rqvtfskRrng+lKKA+EL +LCdaev +iifsstgklye+s+
  Sopen02g036170.2 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGLIIFSSTGKLYEFSN 59
                      8***********************************************95 PP

2K-box78.81.4e-26821701098
             K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                         ++ + +q+e++ L+++++ Lq ++R+llGe+L+ L +keL +Le+qLe slk iR kK+++l+++i+el +k   +++en++L kk+
  Sopen02g036170.2  82 PVSELKLWQREAEILRQQLQDLQDNHRQLLGEELSGLGVKELTNLENQLEMSLKGIRMKKEQILKDEIQELTRKGSIIHQENMELYKKV 170
                       4567789*******************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.903161IPR002100Transcription factor, MADS-box
SMARTSM004329.2E-40160IPR002100Transcription factor, MADS-box
CDDcd002657.07E-45275No hitNo description
SuperFamilySSF554551.96E-32290IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-283859IPR002100Transcription factor, MADS-box
PfamPF014863.0E-2685170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.14786176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGLIIFSS TGKLYEFSNT  60
SMKSVIERYN KTKDDCQQLH NPVSELKLWQ REAEILRQQL QDLQDNHRQL LGEELSGLGV  120
KELTNLENQL EMSLKGIRMK KEQILKDEIQ ELTRKGSIIH QENMELYKKV NLIRQENAEL  180
YKKAYGTRDA NAVNGNINYP YRFTVSREVQ APIHLQLSQP EPQYFEMQAG TSDSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D6e-19270169MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C6e-19270169MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B6e-19270169MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A6e-19270169MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J8e-19269168Myocyte-specific enhancer factor 2A
3p57_I8e-19269168Myocyte-specific enhancer factor 2A
3p57_D8e-19269168Myocyte-specific enhancer factor 2A
3p57_C8e-19269168Myocyte-specific enhancer factor 2A
3p57_B8e-19269168Myocyte-specific enhancer factor 2A
3p57_A8e-19269168Myocyte-specific enhancer factor 2A
3kov_J8e-19269168Myocyte-specific enhancer factor 2A
3kov_I8e-19269168Myocyte-specific enhancer factor 2A
3kov_B8e-19269168Myocyte-specific enhancer factor 2A
3kov_A8e-19269168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754412e-96HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015065370.11e-174PREDICTED: MADS-box transcription factor 23
SwissprotQ6EP491e-111MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLK4BCV31e-173K4BCV3_SOLLC; Uncharacterized protein
STRINGSolyc02g091550.1.11e-173(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6792056
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.11e-99AGAMOUS-like 21